DPCfam | MC261297
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 581 |
|---|---|
| Mean domain length (aa) | 175 ± 34 aa |
| Residues in low-complexity regions (%) | 1.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10127 |
| Sequences matching dominant architecture (%) | 99.11 |
| Average overlap percent | 83.59 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R5P942 | 12-137 | 126 | RLLYRYIRGSHLYGLQMEDGSSDIDEGGLYIASSEDFFGLPTNYSPQVSDERNDTTWYEIGKFCEMLIKSNSAVLEALFVPSDKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P94389-F1 | 16-199 | 100.00 | 93.77 | View in AlphaFoldDB ↗ |