DPCfam | MC260621
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 254 ± 33 aa |
| Residues in low-complexity regions (%) | 13.53 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 76.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060XMV1 | 1453-1731 | 279 | PALVPLPDATPPTTSAMGTKSPDFSNQNSSDQANEEWETASESSDFNERREREERRGALEAANAATQPSAPAPLPPQGSAPPSRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JSZ5-F1 | 1354-1606 | 100.00 | 35.48 | View in AlphaFoldDB ↗ |