DPCfam | MC260060
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Residues in low-complexity regions (%) | 3.38 |
| Residues in coiled-coil regions (%) | 1.2 |
| Predicted disordered residues (%) | 7.32 |
| Average transmembrane regions | 1.92 |
| Dominant Pfam architecture(s) | PF03348 |
| Sequences matching dominant architecture (%) | 98.97 |
| Average overlap percent | 40.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J3IYW0 | 239-310 | 72 | IPYSYGFFHLVFSLGAMYFAMLFISWNLAHPARKWSMDVGWTSTWVKIVNEWFAAAIYLWKLIAPIMRQNRV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95XV3-F1 | 378-458 | 97.59 | 79.58 | View in AlphaFoldDB ↗ |