DPCfam | MC260051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 345 ± 43 aa |
| Residues in low-complexity regions (%) | 9.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 56.76 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 6.0 |
| Average overlap percent | 8.36 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A068TRG4 | 157-534 | 378 | KFFAKVARDSNECEGSLNPIEIPPPRPKKKPAHPYPRKVMDVTKTTLDDPHQPEQAPPFKRSGEERNSRSPTSVLSALGSDTSGS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1MQL7-F1 | 103-477 | 100.00 | 49.92 | View in AlphaFoldDB ↗ |