DPCfam | MC259927
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 260 ± 54 aa |
| Residues in low-complexity regions (%) | 5.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.37 |
| Average transmembrane regions | 3.12 |
| Dominant Pfam architecture(s) | PF03820 |
| Sequences matching dominant architecture (%) | 85.66 |
| Average overlap percent | 94.12 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7Y406 | 27-352 | 326 | GRLRHFYSTVNPLNILVSSEGLETSRKVISDYKKGIVGPSLTVDQLWRHKQIYDSAFHPETGEKMFILGRMSAQVPCNMIITGGL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R5W5-F1 | 31-322 | 100.00 | 86.81 | View in AlphaFoldDB ↗ |