DPCfam | MC259833
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 101 ± 15 aa |
| Residues in low-complexity regions (%) | 0.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.99 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04724 |
| Sequences matching dominant architecture (%) | 93.4 |
| Average overlap percent | 36.66 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A093ZVK1 | 342-425 | 84 | MQNAAWHCSYCLKSLSDMVNKVTSFSHIEFNKPEFRDPEKILNRVRHGLDFFDREDSFFDRVENNLDVPEFLKAHSDRYAFAVN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NYK4-F1 | 282-381 | 94.23 | 95.15 | View in AlphaFoldDB ↗ |