DPCfam | MC259521
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 161 ± 17 aa |
| Residues in low-complexity regions (%) | 7.39 |
| Residues in coiled-coil regions (%) | 0.24 |
| Predicted disordered residues (%) | 41.01 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF02854 |
| Sequences matching dominant architecture (%) | 46.15 |
| Average overlap percent | 24.16 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009480E80 | 319-489 | 171 | LRCAAQALKLTGGAFEDYLDLKEENVEESKKEMDEIFSKLKKSAAERRSDISKNVLLLIVTVVELRAKNWNKEEPAPAAAAALPS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JVP5-F1 | 228-393 | 96.93 | 80.07 | View in AlphaFoldDB ↗ |