DPCfam | MC259429
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Residues in low-complexity regions (%) | 8.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.52 |
| Average transmembrane regions | 3.76 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165LJV4 | 119-320 | 202 | FRSPLRSTWLTSVFGAVLLVALPIVILTGLLSYSAYGPQFGQAKPGAVGWLRLPFFDWPTNPAWLYQLTQGLHVGLGLIIVPLVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FHY0-F1 | 9-196 | 99.43 | 94.10 | View in AlphaFoldDB ↗ |