DPCfam | MC25941
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Residues in low-complexity regions (%) | 1.63 |
| Residues in coiled-coil regions (%) | 0.6 |
| Predicted disordered residues (%) | 21.88 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13091 |
| Sequences matching dominant architecture (%) | 17.05 |
| Average overlap percent | 26.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F8A364 | 411-490 | 79 | VTVIGSSNYTRRSYSLDLEAGALVVTRGDALRRRLGEEQRWLQEHAREVTRDDFARNDRRVGLHVRVAMWIVQLVGGAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1RDT5-F1 | 463-537 | 98.68 | 95.27 | View in AlphaFoldDB ↗ |