DPCfam | MC259402
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06355 |
| Sequences matching dominant architecture (%) | 96.51 |
| Average overlap percent | 94.15 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S9DK62 | 395-509 | 115 | QLPVYTGGVQWEVGNFHVHSDKDQELSAGQIAIEPRTNKSVCACGRYGIDVGTEGYLDLMDGDTRITTLHFDSHYQSNTNTFQAM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q00050-F1 | 7-134 | 100.00 | 94.79 | View in AlphaFoldDB ↗ |