DPCfam | MC25916
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 203 ± 28 aa |
| Residues in low-complexity regions (%) | 3.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.28 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3ZJ20 | 11-238 | 228 | YSGAVTLAFAGVVLLGARRPAQNTSFDQITVHRINVVEPDGTTRMVLSNNAEFPGAYYLGKEYPRTDRDATGMLFNDEEGTENGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EQV6-F1 | 40-92 | 22.79 | 92.17 | View in AlphaFoldDB ↗ |