DPCfam | MC25914
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 386 ± 92 aa |
| Residues in low-complexity regions (%) | 6.98 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 15.73 |
| Average transmembrane regions | 0.31 |
| Dominant Pfam architecture(s) | PF05327 |
| Sequences matching dominant architecture (%) | 86.26 |
| Average overlap percent | 76.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146LTP3 | 131-539 | 409 | SEWKDGVPTEESVRRFQHIHDAIRQILTIVPMSKDILISQVQSLFPYFKRSAHEHETFIYNVLQIIQYLPGERYGFLKMIITQLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9NYV6-F1 | 183-582 | 99.48 | 87.01 | View in AlphaFoldDB ↗ |