DPCfam | MC259077
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 156 ± 21 aa |
| Residues in low-complexity regions (%) | 1.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09038 |
| Sequences matching dominant architecture (%) | 60.24 |
| Average overlap percent | 69.37 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0X3NUP9 | 456-645 | 190 | SAGDRIYGKWRTDNYFYAGHIVKVFSKNRIRVHFDDNSSGLLSADEIIGQPLLPVGANVAADLLGEGEYEAGYVIADSKTGDSPD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q12888-F1 | 1486-1636 | 96.18 | 80.79 | View in AlphaFoldDB ↗ |