DPCfam | MC259016
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1011 |
|---|---|
| Mean domain length (aa) | 89 ± 12 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 25.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00129 |
| Sequences matching dominant architecture (%) | 93.95 |
| Average overlap percent | 59.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q85ZY9 | 2-91 | 90 | HSLRYFYTALSRPAISEPWYIAVGYLDDTQFVRFDSAGETGTYKLLSPWVEQEGPEYWARETEIVTSNAQFFRENLQTMLDYYNL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G3UXE9-F1 | 53-149 | 98.95 | 95.99 | View in AlphaFoldDB ↗ |