DPCfam | MC258967
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 216 ± 28 aa |
| Residues in low-complexity regions (%) | 10.06 |
| Residues in coiled-coil regions (%) | 0.37 |
| Predicted disordered residues (%) | 3.94 |
| Average transmembrane regions | 5.05 |
| Dominant Pfam architecture(s) | PF01773 |
| Sequences matching dominant architecture (%) | 74.38 |
| Average overlap percent | 32.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7U4M9 | 10-225 | 216 | SKVELIQQRLTQWITRHKRTWQIAGSAVLATAAVTYLGFSIHHDFHGAIPLIVLAVLAVFVAVYYGVKLKWGNRIRTRWLQPARQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HAS3-F1 | 70-287 | 99.10 | 85.15 | View in AlphaFoldDB ↗ |