DPCfam | MC258930
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 165 ± 26 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.13 |
| Average transmembrane regions | 0.99 |
| Dominant Pfam architecture(s) | PF05042 |
| Sequences matching dominant architecture (%) | 90.61 |
| Average overlap percent | 92.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A150PR89 | 12-180 | 169 | RTALEMHSAFFDRNHDGIITLRETYEGLRAIGIGRVLSAWFALVINGALGLPTSRSLVPTLSITLENIHRAKHASDTGVYDKDGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C7J0T2-F1 | 121-299 | 97.81 | 96.97 | View in AlphaFoldDB ↗ |