DPCfam | MC258909
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 286 ± 29 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 1.41 |
| Predicted disordered residues (%) | 26.51 |
| Average transmembrane regions | 0.59 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F5EV42 | 22-312 | 291 | QKLNSKDFELPNIEFNGYPNLFFNVKGSTYSSTLTTPLLNALSELILEIQKSYCLIKYETSNLQRLTLEDRKNIDIIFKIKEGSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FUX2-F1 | 2-76 | 26.42 | 59.80 | View in AlphaFoldDB ↗ |