DPCfam | MC25882
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 267 ± 34 aa |
| Residues in low-complexity regions (%) | 5.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.88 |
| Average transmembrane regions | 0.91 |
| Dominant Pfam architecture(s) | PF07679 |
| Sequences matching dominant architecture (%) | 19.35 |
| Average overlap percent | 33.35 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006B3062E | 16-312 | 297 | LDFCVLARLFLSLKADSKECTPGVMVRRQTVYTVHPGEELRVECPVEFCSSSPPAVYWVKNKENLDWFNITFNSHIKTEWKTLKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7Z6A9-F1 | 25-288 | 97.86 | 69.71 | View in AlphaFoldDB ↗ |