DPCfam | MC25881
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 150 ± 31 aa |
| Residues in low-complexity regions (%) | 3.41 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 32.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01476 |
| Sequences matching dominant architecture (%) | 0.52 |
| Average overlap percent | 6.56 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7ILH9 | 19-165 | 147 | SGRSIGGIKPDIVVEETSRDSLFITNHPVEKGAAISDHAFKMPVECEMRCGWSDSGHFQGYSRAINAALIALQAQRQPFTVVTGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GRX2-F1 | 18-117 | 59.87 | 74.35 | View in AlphaFoldDB ↗ |