DPCfam | MC258732
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Residues in low-complexity regions (%) | 1.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.18 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF04722 |
| Sequences matching dominant architecture (%) | 93.27 |
| Average overlap percent | 89.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I1IU22 | 8-182 | 175 | RFAMVCSSNMNRSMEAHAVLGRAALDVESYGTGSQVKLPGPSMHEPNVYDFGTPYGGIYEDLRRKDPDLYKRNGLLPMLKRNISV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q17QI2-F1 | 8-173 | 100.00 | 97.09 | View in AlphaFoldDB ↗ |