DPCfam | MC258725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 222 ± 41 aa |
| Residues in low-complexity regions (%) | 13.49 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 58.72 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF08312 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 22.04 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182J7S7 | 542-788 | 247 | FKSRVMGVFRAWEEWTIYPREFLVKLQHTFLGIQPMVKREPEEEPEEEKEDEDLDGVPLDGAALLKSAMLCGMASEENRTPLIKH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5R7X2-F1 | 622-884 | 99.57 | 61.76 | View in AlphaFoldDB ↗ |