DPCfam | MC258714
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 0.23 |
| Predicted disordered residues (%) | 20.34 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF08007 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 33.83 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7NJK3 | 213-315 | 103 | DAVLAPGDVLYLPRGTIHAAAAQGEISAHLTIGVHTWTPDHVTGAVLDAVRSRLRDQPTVRANLPLGARPDDAAVVGPTLEQLRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5FAA6-F1 | 190-279 | 96.88 | 96.90 | View in AlphaFoldDB ↗ |