DPCfam | MC258640
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 273 ± 47 aa |
| Residues in low-complexity regions (%) | 0.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.21 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06079 |
| Sequences matching dominant architecture (%) | 87.13 |
| Average overlap percent | 94.56 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8C8N5 | 67-363 | 297 | VISDQDKASKVTTSAGTEYESTVKMGELYISADNSFAKIVWDSTEVALTTQTNTNSRGGEFSDLKWFDAKLTTVDDKTGIIYRIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7EHT1-F1 | 57-348 | 99.32 | 95.28 | View in AlphaFoldDB ↗ |