DPCfam | MC25842
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 151 ± 28 aa |
| Residues in low-complexity regions (%) | 1.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.83 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D9T6T5 | 22-134 | 113 | VEDHMVRADRAGIIWREETVSELLWVHAHPHISCADFSRKQENRVGADWLWWWVDGSGECFGLLVQAKRLHHSQSQQPHAQLDFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A9Z9-F1 | 72-149 | 46.79 | 80.72 | View in AlphaFoldDB ↗ |