DPCfam | MC258055
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 186 ± 41 aa |
| Residues in low-complexity regions (%) | 11.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A118K4G5 | 40-246 | 207 | MKKSRSIKRPDESANLRSSRRKRSXPLVEHGGAAVATSQKQSPNYMKSTSSFEARKERSXSINKNQSPKAENKSKIEVLASGNKG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JWH8-F1 | 99-277 | 95.51 | 54.21 | View in AlphaFoldDB ↗ |