DPCfam | MC257812
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 70 ± 13 aa |
| Residues in low-complexity regions (%) | 2.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15092 |
| Sequences matching dominant architecture (%) | 94.44 |
| Average overlap percent | 87.95 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E4XF99 | 12-92 | 81 | GPYKRFNIVNYGFERLEGIQSLLRNEGVNVILRRSNQFDQCSILYQGKTVFSCPITSLEFGSDGESDPIAQNAFQKVKSAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q08BN1-F1 | 7-91 | 100.00 | 94.52 | View in AlphaFoldDB ↗ |