DPCfam | MC257702
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Residues in low-complexity regions (%) | 1.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.47 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12222 |
| Sequences matching dominant architecture (%) | 99.15 |
| Average overlap percent | 34.35 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1E3QAA8 | 38-163 | 126 | PNTYGAPVFVSTIMEHTFAFSYGRPFVGTYKPAPVNFTHVQFTLSTTSEGRQFDRLALVFIGDHEVWRTSTAEPTLGGIHFQYTK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WH39-F1 | 136-251 | 97.52 | 94.54 | View in AlphaFoldDB ↗ |