DPCfam | MC257680
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 91 ± 10 aa |
| Residues in low-complexity regions (%) | 2.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.52 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16760 |
| Sequences matching dominant architecture (%) | 66.0 |
| Average overlap percent | 83.62 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P7XE00 | 728-819 | 92 | PPVFTVEPDPVIAGQEFTLTYAGSLAGASQVNLHWGYNGWSNVTTTAMTRRDDQWTLTIQAPSDATEINFVFNNGAGTWDNNSGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P23671-F1 | 477-563 | 95.56 | 85.69 | View in AlphaFoldDB ↗ |