DPCfam | MC257442
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Residues in low-complexity regions (%) | 1.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02383 |
| Sequences matching dominant architecture (%) | 1.41 |
| Average overlap percent | 1.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7UN40 | 446-546 | 101 | MGEYFVNQGRDDFWTEVQKMRGNNSATPTIVDDCLSEDDIALCFREKYNTLYNSVGYVPEEMAHLRQEIEANACRHEGEMCRFHV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2KTU9-F1 | 401-471 | 69.81 | 92.45 | View in AlphaFoldDB ↗ |