DPCfam | MC257340
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 312 ± 75 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.22 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF06413 |
| Sequences matching dominant architecture (%) | 93.65 |
| Average overlap percent | 57.9 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A29C1B | 55-298 | 244 | AEKRKTKAIKYRRIRAELGLSGPPPRTLTTQAMQQMRFLRAKFPEEWSVAQLAEGFSVSEDVVLRVLRSKFTPSLKRRMKQDANV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VBR0-F1 | 42-355 | 99.09 | 72.16 | View in AlphaFoldDB ↗ |