DPCfam | MC257320
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 139 ± 28 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12456 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 36.15 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182SB58 | 161-344 | 184 | DPSETEVDTILILTDDCYIVAEYDSHLDKIVRFENVPLESVTLIELGLFQHNKMFQGPAPAHLCIRLNYAVDGVDGYFHMFRSPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0KI33-F1 | 699-840 | 96.45 | 82.97 | View in AlphaFoldDB ↗ |