DPCfam | MC257198
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 407 ± 35 aa |
| Residues in low-complexity regions (%) | 8.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.21 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF05990 |
| Sequences matching dominant architecture (%) | 2.27 |
| Average overlap percent | 24.0 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4A3B6 | 13-438 | 426 | PRWDIEFDADGGRTDGEQDDRLADAAREGGVRHLVFLAHTAHNDADTSTDVDTRFRDLFTDVTADDGVGFVSVRWPGMTFASEPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2K9-F1 | 51-110 | 13.57 | 94.67 | View in AlphaFoldDB ↗ |