DPCfam | MC257125
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 207 ± 24 aa |
| Residues in low-complexity regions (%) | 4.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.29 |
| Average transmembrane regions | 0.17 |
| Dominant Pfam architecture(s) | PF10633 |
| Sequences matching dominant architecture (%) | 1.1 |
| Average overlap percent | 35.07 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S3UC34 | 121-362 | 242 | LRLELPVKQFQLHPTDSATIPVRIKNPGQNPAEAKISIVGLPNEWLTTPDTQGIRINPGATIEIEFTAVLPDLIAAKSHTYPFTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A8JFU2-F1 | 53-205 | 79.90 | 86.44 | View in AlphaFoldDB ↗ |