DPCfam | MC256950
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 382 ± 73 aa |
| Residues in low-complexity regions (%) | 5.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.67 |
| Average transmembrane regions | 1.77 |
| Dominant Pfam architecture(s) | PF00520 |
| Sequences matching dominant architecture (%) | 1.09 |
| Average overlap percent | 34.96 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00068F6FF3 | 45-458 | 414 | DFYLRRLPQLTEWYGRQFKGIEPHRMTTAYLDAVQQLEEQVALTGLQSPEVNQQLLNLQRLSVEMVDENPFDGANKTGTLERIKN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1C3L3-F1 | 533-709 | 45.16 | 31.13 | View in AlphaFoldDB ↗ |