DPCfam | MC256801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 198 ± 24 aa |
| Residues in low-complexity regions (%) | 2.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7YHZ6 | 1872-2028 | 157 | LIDVGSELNGAIEAFGSSFWQLLIAKVPVLAHYARGQTPLTSMDYSDRYLLAPLPLRLIIEVLAHAPGRTSQTTIRVATAQGGLN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39393-F1 | 696-884 | 95.48 | 92.48 | View in AlphaFoldDB ↗ |