DPCfam | MC256603
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1731 |
|---|---|
| Mean domain length (aa) | 165 ± 17 aa |
| Residues in low-complexity regions (%) | 11.2 |
| Residues in coiled-coil regions (%) | 0.37 |
| Predicted disordered residues (%) | 3.28 |
| Average transmembrane regions | 3.79 |
| Dominant Pfam architecture(s) | PF01292 |
| Sequences matching dominant architecture (%) | 99.41 |
| Average overlap percent | 96.87 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0R3KS49 | 4-169 | 166 | YDSTTITLHWVIAILVTIRFLIGRTTNFLPRGSLRVDIWSVHVVFGFAFASAVVLEMLWRATRSRRLAPLDRGLIHLTAVAMHRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I691-F1 | 9-179 | 99.35 | 96.60 | View in AlphaFoldDB ↗ |