DPCfam | MC256400
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Residues in low-complexity regions (%) | 5.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.2 |
| Average transmembrane regions | 0.49 |
| Dominant Pfam architecture(s) | PF00899- PF09358 |
| Sequences matching dominant architecture (%) | 65.11 |
| Average overlap percent | 32.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A183JUS5 | 3-125 | 123 | KSKLIAGKIIPAIATTTSLVAGLVCLELLKLVQGHKKLELFKNAYVDLALPFTSFYEPVAPIKSKYYDTEFSLWDRFELSGPMTL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1RCA1-F1 | 859-1039 | 100.00 | 94.97 | View in AlphaFoldDB ↗ |