DPCfam | MC255977
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 611 |
|---|---|
| Mean domain length (aa) | 125 ± 18 aa |
| Residues in low-complexity regions (%) | 1.95 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 23.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17775 |
| Sequences matching dominant architecture (%) | 47.92 |
| Average overlap percent | 83.05 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9I4T5 | 6-140 | 135 | CPCGSGDPLDDCCGRYHQGHPAPTAEALMRSRYSAYALGLVDYLRDTTLPAQQAGLDLDGIRAWSHGSTWLGLEVENHEVLGGQP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B4EXS5-F1 | 5-129 | 99.18 | 95.45 | View in AlphaFoldDB ↗ |