DPCfam | MC255892
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 731 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Residues in low-complexity regions (%) | 1.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.02 |
| Average transmembrane regions | 0.19 |
| Dominant Pfam architecture(s) | PF02862 |
| Sequences matching dominant architecture (%) | 98.53 |
| Average overlap percent | 49.66 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A095A163 | 642-743 | 102 | RMSSLDFQVQNFFMLGSPIGLILAYRYQQNQLTSSIVSSSKTNQLITNSSYNMVYHLSKEIKLSVGQAYNLFHLTDPCGFRIEPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LFN8-F1 | 650-733 | 98.80 | 91.42 | View in AlphaFoldDB ↗ |