DPCfam | MC255877
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 167 ± 13 aa |
| Residues in low-complexity regions (%) | 0.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05547 |
| Sequences matching dominant architecture (%) | 96.47 |
| Average overlap percent | 38.62 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E75A5C | 641-805 | 165 | AEKDPSAFTLKGFEKSDGNKYSDHYYLLEWRNQQGVDEGLAHIKRGSSLMSYDGGLVVWYVDPTYTDNWTGVHPGDGFLGVVDSH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C3LUP3-F1 | 581-749 | 99.41 | 94.52 | View in AlphaFoldDB ↗ |