DPCfam | MC255749
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Residues in low-complexity regions (%) | 7.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.48 |
| Average transmembrane regions | 0.97 |
| Dominant Pfam architecture(s) | PF00654 |
| Sequences matching dominant architecture (%) | 94.92 |
| Average overlap percent | 8.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M7BC15 | 1301-1380 | 80 | WYSHEQCCWTSNETTFDDRDKCPLWQKWSELLVNRSEGASAYILNYFLYIMWALSFAFLAVSLVRVFAPYACGSGIPEIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9TTU3-F1 | 165-247 | 98.73 | 83.35 | View in AlphaFoldDB ↗ |