DPCfam | MC25561
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 206 ± 23 aa |
| Residues in low-complexity regions (%) | 4.45 |
| Residues in coiled-coil regions (%) | 2.74 |
| Predicted disordered residues (%) | 4.32 |
| Average transmembrane regions | 3.59 |
| Dominant Pfam architecture(s) | PF10271 |
| Sequences matching dominant architecture (%) | 92.21 |
| Average overlap percent | 73.06 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8GZP4 | 240-445 | 206 | EKIRDETEALKSDFNGRLKIILFSTLFSSFHSAFVPLLFVQNTIYLEPWFCGVHVAVTVASAFLFYTQHHLPPHRIDTLHRCALH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6PH58-F1 | 258-468 | 99.53 | 89.53 | View in AlphaFoldDB ↗ |