DPCfam | MC25543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 217 ± 61 aa |
| Residues in low-complexity regions (%) | 15.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.58 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF03468 |
| Sequences matching dominant architecture (%) | 5.08 |
| Average overlap percent | 4.39 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151S955 | 215-450 | 236 | KEDENLDGKVLELSSENGGEIVKESHESMVSDAEWVCENPKAGVSSTASGWPSFDDIKSSSLIYSLSAEEKLTVAVLQLQHKALE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1M303-F1 | 27-223 | 76.38 | 66.80 | View in AlphaFoldDB ↗ |