DPCfam | MC255038
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 194 ± 14 aa |
| Residues in low-complexity regions (%) | 10.1 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.81 |
| Average transmembrane regions | 1.07 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00082BBA3B | 282-461 | 180 | LVYYERGRGRLTLMTDGSLWQNDRIGEFDHAYFLAHLVGERDLVMVTRPRFDTLGTLIQRYALELLVAGLLALAAWIANRSRRFG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HW80-F1 | 228-421 | 98.48 | 87.45 | View in AlphaFoldDB ↗ |