DPCfam | MC255021
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Residues in low-complexity regions (%) | 2.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06809 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 37.51 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007DCADBA | 110-212 | 103 | WAPLFGQAAVFAALWTISTCLTGSHLCPRSLDCAQAGRHFCQPGRSHCGPCLHHLVENSNGQCVVKRRHVAHSAHLDKGKTSTHP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QQY1-F1 | 32-105 | 94.87 | 75.35 | View in AlphaFoldDB ↗ |