DPCfam | MC254942
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Residues in low-complexity regions (%) | 1.99 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 24.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00408 |
| Sequences matching dominant architecture (%) | 57.89 |
| Average overlap percent | 53.74 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P36871-2 | 486-581 | 95 | VEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SCY0-F1 | 532-623 | 97.87 | 93.92 | View in AlphaFoldDB ↗ |