DPCfam | MC25473
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 135 ± 23 aa |
| Residues in low-complexity regions (%) | 9.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.98 |
| Average transmembrane regions | 0.88 |
| Dominant Pfam architecture(s) | PF16066 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 90.2 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A067RD60 | 47-170 | 124 | IVVRAEEALIVLLVLVLWIAAIALFFNRWGKIRMLEPYQPKFQQQHRSSCPMVDINGPIGLQHRTFSKFNVNCIGEPIHTLHRPR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W3T1-F1 | 116-258 | 98.60 | 57.27 | View in AlphaFoldDB ↗ |