DPCfam | MC254543
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 201 ± 34 aa |
| Residues in low-complexity regions (%) | 4.54 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 7.07 |
| Average transmembrane regions | 0.13 |
| Dominant Pfam architecture(s) | PF15787 |
| Sequences matching dominant architecture (%) | 19.23 |
| Average overlap percent | 71.59 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A28AB27 | 1363-1547 | 185 | GVRVFHSSPAANSLNFIGGPAILLGMISLATDDHTMYAAIKVLHSVLSSSSMCDNLMKQIQGYQILTLLLKKKRQLLNNRIFQLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QFZ1-F1 | 608-840 | 98.58 | 85.00 | View in AlphaFoldDB ↗ |