DPCfam | MC254350
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Residues in low-complexity regions (%) | 1.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04151 |
| Sequences matching dominant architecture (%) | 1.85 |
| Average overlap percent | 70.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H1Z2I9 | 113-203 | 91 | SISDGEKKYFHRDMPEDLDRFTYDLVWGDAEDSLKLTIFAPDGVMGPYYDDSDGVVNGRIFLQISRPDGIDPGDWYAVVEGERVF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O28707-F1 | 22-69 | 50.00 | 88.83 | View in AlphaFoldDB ↗ |