DPCfam | MC254236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 711 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Residues in low-complexity regions (%) | 3.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.01 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04844 |
| Sequences matching dominant architecture (%) | 98.04 |
| Average overlap percent | 82.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M8ATC8 | 111-178 | 68 | GAIGVGMAVVKRSSNPYADFRSSMVEMVVERRIASVGKMEELLESYLSLNSPEHHPAIIAAFEDVWEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JF95-F1 | 128-201 | 98.57 | 91.72 | View in AlphaFoldDB ↗ |